Lineage for d1d9kd1 (1d9k D:93-190)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026816Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2026889Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2026913Domain d1d9kd1: 1d9k D:93-190 [21628]
    Other proteins in same PDB: d1d9ka_, d1d9kb_, d1d9kc1, d1d9kc2, d1d9kd2, d1d9ke_, d1d9kf_, d1d9kg1, d1d9kg2, d1d9kh2
    complexed with ndg

Details for d1d9kd1

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca
PDB Compounds: (D:) MHC I-ak b chain (beta chain)

SCOPe Domain Sequences for d1d9kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9kd1 b.1.1.2 (D:93-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
rleqpsvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtprrgevytchvehpslkspitvewra

SCOPe Domain Coordinates for d1d9kd1:

Click to download the PDB-style file with coordinates for d1d9kd1.
(The format of our PDB-style files is described here.)

Timeline for d1d9kd1: