| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Pseudomonas stutzeri [TaxId:316] [226186] (22 PDB entries) |
| Domain d3sbpa2: 3sbp A:508-638 [216279] Other proteins in same PDB: d3sbpa1, d3sbpb1, d3sbpc1, d3sbpd1, d3sbpe1, d3sbpf1, d3sbpg1, d3sbph1 automated match to d1qnia1 complexed with ca, cl, cua, cuk, imd, k |
PDB Entry: 3sbp (more details), 2.1 Å
SCOPe Domain Sequences for d3sbpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbpa2 b.6.1.0 (A:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa
Timeline for d3sbpa2: