Lineage for d3sbka_ (3sbk A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1547083Protein automated matches [190044] (14 species)
    not a true protein
  7. 1547111Species Daboia russellii [TaxId:343250] [196182] (3 PDB entries)
  8. 1547114Domain d3sbka_: 3sbk A: [216277]
    automated match to d3s9ba_
    complexed with 0g6, nag

Details for d3sbka_

PDB Entry: 3sbk (more details), 2.55 Å

PDB Description: russell's viper venom serine proteinase, rvv-v (ppack-bound form)
PDB Compounds: (A:) Vipera russelli proteinase RVV-V gamma

SCOPe Domain Sequences for d3sbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbka_ b.47.1.2 (A:) automated matches {Daboia russellii [TaxId: 343250]}
vvggdecninehpflvalytsasstihcagalinrewvltaahcdrrniriklgmhskni
rnedeqirvprgkyfclntkfpngldkdimlirlrrpvtysthiapvslpsrsrgvgsrc
rimgwgkistttypdvphctnifivkhkwceplypwvpadsrtlcagilkggrdtchgds
ggplicngemhgivaggsepcgqhlkpavytkvfdynnwiqsiiagnrtvtcpp

SCOPe Domain Coordinates for d3sbka_:

Click to download the PDB-style file with coordinates for d3sbka_.
(The format of our PDB-style files is described here.)

Timeline for d3sbka_: