| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (107 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (12 PDB entries) |
| Domain d3sbcj_: 3sbc J: [216276] Other proteins in same PDB: d3sbcb_ automated match to d1uula_ complexed with dtu, dtv; mutant |
PDB Entry: 3sbc (more details), 2.8 Å
SCOPe Domain Sequences for d3sbcj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbcj_ c.47.1.0 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaqvqkqaptfkktavvdgvfdevsldkykgkyvvlafiplaftfvspteiiafseaakk
feeqgaqvlfastdseysllawtniprkegglgpiniplladtnhslsrdygvlieeegv
alrglfiidpkgvirhitindlpvgrnvdealrlveafqwtdkngtvlpcnwtpgaatik
ptvedskeyfeaank
Timeline for d3sbcj_: