Lineage for d3sbcg_ (3sbc G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879136Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (14 PDB entries)
  8. 2879167Domain d3sbcg_: 3sbc G: [216273]
    Other proteins in same PDB: d3sbcb1, d3sbcb2
    automated match to d1uula_
    complexed with dtu, dtv; mutant

Details for d3sbcg_

PDB Entry: 3sbc (more details), 2.8 Å

PDB Description: Crystal structure of Saccharomyces cerevisiae TSA1C47S mutant protein
PDB Compounds: (G:) Peroxiredoxin TSA1

SCOPe Domain Sequences for d3sbcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbcg_ c.47.1.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaqvqkqaptfkktavvdgvfdevsldkykgkyvvlafiplaftfvspteiiafseaakk
feeqgaqvlfastdseysllawtniprkegglgpiniplladtnhslsrdygvlieeegv
alrglfiidpkgvirhitindlpvgrnvdealrlveafqwtdkngtvlpcnwtpgaatik
ptvedskeyfeaank

SCOPe Domain Coordinates for d3sbcg_:

Click to download the PDB-style file with coordinates for d3sbcg_.
(The format of our PDB-style files is described here.)

Timeline for d3sbcg_: