Lineage for d3sbca_ (3sbc A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487045Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (14 PDB entries)
  8. 2487062Domain d3sbca_: 3sbc A: [216267]
    Other proteins in same PDB: d3sbcb1, d3sbcb2
    automated match to d1uula_
    complexed with dtu, dtv; mutant

Details for d3sbca_

PDB Entry: 3sbc (more details), 2.8 Å

PDB Description: Crystal structure of Saccharomyces cerevisiae TSA1C47S mutant protein
PDB Compounds: (A:) Peroxiredoxin TSA1

SCOPe Domain Sequences for d3sbca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbca_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaqvqkqaptfkktavvdgvfdevsldkykgkyvvlafiplaftfvspteiiafseaakk
feeqgaqvlfastdseysllawtniprkegglgpiniplladtnhslsrdygvlieeegv
alrglfiidpkgvirhitindlpvgrnvdealrlveafqwtdkngtvlpcnwtpgaatik
ptvedskeyfeaank

SCOPe Domain Coordinates for d3sbca_:

Click to download the PDB-style file with coordinates for d3sbca_.
(The format of our PDB-style files is described here.)

Timeline for d3sbca_: