Lineage for d3sanb_ (3san B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065391Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2065392Protein automated matches [190692] (15 species)
    not a true protein
  7. 2065519Species Influenza A virus [TaxId:385582] [189809] (3 PDB entries)
  8. 2065523Domain d3sanb_: 3san B: [216264]
    automated match to d3ti8a_
    complexed with ca, gol, nag, zmr

Details for d3sanb_

PDB Entry: 3san (more details), 1.6 Å

PDB Description: Crystal structure of influenza A virus neuraminidase N5 complexed with Zanamivir
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d3sanb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sanb_ b.68.1.0 (B:) automated matches {Influenza A virus [TaxId: 385582]}
peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
iwtsssstvfcgvssevpgwswddgailpfdidk

SCOPe Domain Coordinates for d3sanb_:

Click to download the PDB-style file with coordinates for d3sanb_.
(The format of our PDB-style files is described here.)

Timeline for d3sanb_: