SCOPe 2.04: Domain d3sana_: 3san A:

Lineage for d3sana_ (3san A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.0: automated matches [191452] (1 protein)
   not a true family

6. Protein automated matches [190692] (9 species)
   not a true protein

7. Species Influenza A virus [TaxId:385582] [189809] (3 PDB entries)

8. Domain d3sana_: 3san A: [216263]
   automated match to d3ti8a_
   complexed with ca, gol, nag, zmr

Details for d3sana_

PDB Entry: 3san, 1.6 Å

PDB Description: crystal structure of influenza a virus neuraminidase n5 complexed with zanamivir

PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d3sana_:

Sequence; same for both SEQRES and ATOM records:

>d3sana_ b.68.1.0 (A:) automated matches {Influenza A virus [TaxId: 385582]}
peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
iwtsssstvfcgvssevpgwswddgailpfdidk

Timeline for d3sana_:

• d3sana_ first appeared in SCOPe 2.03
  
• d3sana_ appears in SCOPe 2.05
  
• d3sana_ appears in the current release, SCOPe 2.08