Lineage for d3s9ia_ (3s9i A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088435Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2088436Family c.1.13.1: Malate synthase G [51646] (2 protein domains)
  6. 2088450Protein automated matches [195320] (6 species)
    not a true protein
  7. 2088454Species Mycobacterium tuberculosis [TaxId:1773] [226813] (5 PDB entries)
  8. 2088457Domain d3s9ia_: 3s9i A: [216260]
    automated match to d4ex4a_
    complexed with mg, xi7

Details for d3s9ia_

PDB Entry: 3s9i (more details), 1.9 Å

PDB Description: crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-4-dioxo-4-phenylbutanoic acid inhibitor
PDB Compounds: (A:) malate synthase g

SCOPe Domain Sequences for d3s9ia_:

Sequence, based on SEQRES records: (download)

>d3s9ia_ c.1.13.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
lnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvp
lssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhiei
lidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaa
avdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfeg
imdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlg
lpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkg
tmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastaw
vpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnn
cqsilgyvvrwvdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvras
lermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrref
karaae

Sequence, based on observed residues (ATOM records): (download)

>d3s9ia_ c.1.13.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
lnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvp
lssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhiei
lidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaa
lrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftgl
iaihglkasdgplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigim
deerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilay
edhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlha
lhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrw
vdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrq
nadvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae

SCOPe Domain Coordinates for d3s9ia_:

Click to download the PDB-style file with coordinates for d3s9ia_.
(The format of our PDB-style files is described here.)

Timeline for d3s9ia_: