Lineage for d1iakb1 (1iak B:93-190)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933150Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 933219Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 933220Domain d1iakb1: 1iak B:93-190 [21626]
    Other proteins in same PDB: d1iaka1, d1iaka2, d1iakb2
    complexed with nag

Details for d1iakb1

PDB Entry: 1iak (more details), 1.9 Å

PDB Description: histocompatibility antigen i-ak
PDB Compounds: (B:) MHC class II I-ak

SCOPe Domain Sequences for d1iakb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iakb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
rleqpsvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtprrgevytchvehpsltspitvewra

SCOPe Domain Coordinates for d1iakb1:

Click to download the PDB-style file with coordinates for d1iakb1.
(The format of our PDB-style files is described here.)

Timeline for d1iakb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iakb2