SCOP 1.63: Domain d1iakb1: 1iak B:93-190

Lineage for d1iakb1 (1iak B:93-190)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Mouse (Mus musculus), I-AK [TaxId:10090] [49138] (3 PDB entries)

8. Domain d1iakb1: 1iak B:93-190 [21626]
   Other proteins in same PDB: d1iaka2, d1iakb2
   complexed with nag

Details for d1iakb1

PDB Entry: 1iak, 1.9 Å

PDB Description: histocompatibility antigen i-ak

SCOP Domain Sequences for d1iakb1:

Sequence; same for both SEQRES and ATOM records:

>d1iakb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AK}
rleqpsvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtprrgevytchvehpsltspitvewra

Timeline for d1iakb1:

• d1iakb1 first appeared (with stable ids) in SCOP 1.55
  
• d1iakb1 appears in SCOP 1.61
  
• d1iakb1 appears in SCOP 1.65
  
• d1iakb1 appears in the current release, SCOPe 2.08