Lineage for d1iakb1 (1iak B:93-190)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8374Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)
  7. 8434Species Mouse (Mus musculus), I-AK [TaxId:10090] [49138] (2 PDB entries)
  8. 8436Domain d1iakb1: 1iak B:93-190 [21626]
    Other proteins in same PDB: d1iaka2, d1iakb2

Details for d1iakb1

PDB Entry: 1iak (more details), 1.9 Å

PDB Description: histocompatibility antigen i-ak

SCOP Domain Sequences for d1iakb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iakb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AK}
rleqpsvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtprrgevytchvehpsltspitvewra

SCOP Domain Coordinates for d1iakb1:

Click to download the PDB-style file with coordinates for d1iakb1.
(The format of our PDB-style files is described here.)

Timeline for d1iakb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iakb2