Lineage for d3s9aa_ (3s9a A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406349Protein automated matches [190044] (14 species)
    not a true protein
  7. 2406388Species Daboia russellii [TaxId:343250] [196182] (3 PDB entries)
  8. 2406390Domain d3s9aa_: 3s9a A: [216256]
    automated match to d3s9ba_
    complexed with nag

Details for d3s9aa_

PDB Entry: 3s9a (more details), 1.9 Å

PDB Description: russell's viper venom serine proteinase, rvv-v (closed-form)
PDB Compounds: (A:) Vipera russelli proteinase RVV-V gamma

SCOPe Domain Sequences for d3s9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s9aa_ b.47.1.2 (A:) automated matches {Daboia russellii [TaxId: 343250]}
vvggdecninehpflvalytsasstihcagalinrewvltaahcdrrniriklgmhskni
rnedeqirvprgkyfclntkfpngldkdimlirlrrpvtysthiapvslpsrsrgvgsrc
rimgwgkistttypdvphctnifivkhkwceplypwvpadsrtlcagilkggrdtchgds
ggplicngemhgivaggsepcgqhlkpavytkvfdynnwiqsiiagnrtvtcpp

SCOPe Domain Coordinates for d3s9aa_:

Click to download the PDB-style file with coordinates for d3s9aa_.
(The format of our PDB-style files is described here.)

Timeline for d3s9aa_: