SCOPe 2.03: Domain d3s96d2: 3s96 D:358-458

Lineage for d3s96d2 (3s96 D:358-458)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d3s96d2: 3s96 D:358-458 [216255]
   automated match to d1q1jl2

Details for d3s96d2

PDB Entry: 3s96, 1.9 Å

PDB Description: Crystal structure of 3B5H10

PDB Compounds: (D:) 3B5H10 FAB light chain

SCOPe Domain Sequences for d3s96d2:

Sequence, based on SEQRES records:

>d3s96d2 b.1.1.0 (D:358-458) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pkstptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkeg
nkfmassflhltsdqwrshnsftcqvthegdtvekslspae

Sequence, based on observed residues (ATOM records):

>d3s96d2 b.1.1.0 (D:358-458) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pkstptltvfppsseelkenkatlvclisnfspsgvtvawkangtpikfmassflhltsd
qwrshnsftcqvthegdtvekslspae

Timeline for d3s96d2:

• d3s96d2 is new in SCOPe 2.03-stable
  
• d3s96d2 appears in SCOPe 2.04
  
• d3s96d2 appears in the current release, SCOPe 2.08