Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.0: automated matches [227135] (1 protein) not a true family |
Protein automated matches [226836] (5 species) not a true protein |
Species Wu polyomavirus [TaxId:440266] [226166] (1 PDB entry) |
Domain d3s7xc_: 3s7x C: [216248] automated match to d1vpsa_ complexed with cl, gol, na; mutant |
PDB Entry: 3s7x (more details), 2.9 Å
SCOPe Domain Sequences for d3s7xc_:
Sequence, based on SEQRES records: (download)
>d3s7xc_ b.121.6.0 (C:) automated matches {Wu polyomavirus [TaxId: 440266]} shmggvdvlaavplseetefkvelfvkpvignaegttphywsissplktaeaanvtpdad ttvcyslsqvappdipnqvsecdmliwelyrmetevlvlpvlnagilttggvggiagpql yfwavggqpldvlglaptekykgpaqytvnpktngtvphvysssetpkarvtnekysies wvadpsrndncryfgrmvggaatppvvsfsnnstiplldengigilclqgrlyitcadll gvnknrvhtglsrffrlhfrqrrvrn
>d3s7xc_ b.121.6.0 (C:) automated matches {Wu polyomavirus [TaxId: 440266]} shmggvdvlaavplseetefkvelfvkpvignaegttphywsissplktaeaanvtpdad ttvcyslsqvappdipnecdmliwelyrmetevlvlpvlnagilttggvggiagpqlyfw avggqpldvlglaptekykgpaqytvnpktngtvphvysssetpkarvtnekysieswva dpsrndncryfgrmvggaatppvvsfsnnstiplldengigilclqgrlyitcadllgvn knrvhtglsrffrlhfrqrrvrn
Timeline for d3s7xc_:
View in 3D Domains from other chains: (mouse over for more information) d3s7xa_, d3s7xb_, d3s7xd_, d3s7xe_ |