Lineage for d3s7xb1 (3s7x B:34-296)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076457Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2076790Family b.121.6.0: automated matches [227135] (1 protein)
    not a true family
  6. 2076791Protein automated matches [226836] (6 species)
    not a true protein
  7. 2076857Species Wu polyomavirus [TaxId:440266] [226166] (1 PDB entry)
  8. 2076859Domain d3s7xb1: 3s7x B:34-296 [216247]
    Other proteins in same PDB: d3s7xa2, d3s7xb2, d3s7xc2
    automated match to d1vpsa_
    complexed with cl, gol, na; mutant

Details for d3s7xb1

PDB Entry: 3s7x (more details), 2.9 Å

PDB Description: Unassembled Washington University Polyomavirus VP1 Pentamer R198K Mutant
PDB Compounds: (B:) Major capsid protein VP1

SCOPe Domain Sequences for d3s7xb1:

Sequence, based on SEQRES records: (download)

>d3s7xb1 b.121.6.0 (B:34-296) automated matches {Wu polyomavirus [TaxId: 440266]}
ggvdvlaavplseetefkvelfvkpvignaegttphywsissplktaeaanvtpdadttv
cyslsqvappdipnqvsecdmliwelyrmetevlvlpvlnagilttggvggiagpqlyfw
avggqpldvlglaptekykgpaqytvnpktngtvphvysssetpkarvtnekysieswva
dpsrndncryfgrmvggaatppvvsfsnnstiplldengigilclqgrlyitcadllgvn
knrvhtglsrffrlhfrqrrvrn

Sequence, based on observed residues (ATOM records): (download)

>d3s7xb1 b.121.6.0 (B:34-296) automated matches {Wu polyomavirus [TaxId: 440266]}
ggvdvlaavplseetefkvelfvkpvignaegttphywsissplktaeaanvtpdadttv
cyslsqvappdipecdmliwelyrmetevlvlpvlnagilttggvggiagpqlyfwavgg
qpldvlglaptekykgpaqytvnpktngtvphvysssetpkarvtnekysieswvadpsr
ndncryfgrmvggaatppvvsfsnnstiplldengigilclqgrlyitcadllgvnknrv
htglsrffrlhfrqrrvrn

SCOPe Domain Coordinates for d3s7xb1:

Click to download the PDB-style file with coordinates for d3s7xb1.
(The format of our PDB-style files is described here.)

Timeline for d3s7xb1: