SCOPe 2.07: Domain d3s7xa1: 3s7x A:34-296

Lineage for d3s7xa1 (3s7x A:34-296)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families)

5. Family b.121.6.0: automated matches [227135] (1 protein)
   not a true family

6. Protein automated matches [226836] (7 species)
   not a true protein

7. Species Wu polyomavirus [TaxId:440266] [226166] (1 PDB entry)

8. Domain d3s7xa1: 3s7x A:34-296 [216246]
   Other proteins in same PDB: d3s7xa2, d3s7xb2, d3s7xc2
   automated match to d1vpsa_
   complexed with cl, gol, na; mutant

Details for d3s7xa1

PDB Entry: 3s7x, 2.9 Å

PDB Description: Unassembled Washington University Polyomavirus VP1 Pentamer R198K Mutant

PDB Compounds: (A:) Major capsid protein VP1

SCOPe Domain Sequences for d3s7xa1:

Sequence, based on SEQRES records:

>d3s7xa1 b.121.6.0 (A:34-296) automated matches {Wu polyomavirus [TaxId: 440266]}
ggvdvlaavplseetefkvelfvkpvignaegttphywsissplktaeaanvtpdadttv
cyslsqvappdipnqvsecdmliwelyrmetevlvlpvlnagilttggvggiagpqlyfw
avggqpldvlglaptekykgpaqytvnpktngtvphvysssetpkarvtnekysieswva
dpsrndncryfgrmvggaatppvvsfsnnstiplldengigilclqgrlyitcadllgvn
knrvhtglsrffrlhfrqrrvrn

Sequence, based on observed residues (ATOM records):

>d3s7xa1 b.121.6.0 (A:34-296) automated matches {Wu polyomavirus [TaxId: 440266]}
ggvdvlaavplseetefkvelfvkpvignaegttphywsissplktaeaanvtpdadttv
cyslsqvappdipnecdmliwelyrmetevlvlpvlnagilttggvggiagpqlyfwavg
gqpldvlglaptekykgpaqytvnpktngtvphvysssetpkarvtnekysieswvadps
rndncryfgrmvggaatppvvsfsnnstiplldengigilclqgrlyitcadllgvnknr
vhtglsrffrlhfrqrrvrn

Timeline for d3s7xa1:

• d3s7xa1 first appeared in SCOPe 2.03, called d3s7xa_
  
• d3s7xa1 appears in SCOPe 2.06
  
• d3s7xa1 appears in the current release, SCOPe 2.08