Lineage for d1d5xb1 (1d5x B:93-190)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220790Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (5 PDB entries)
  8. 220798Domain d1d5xb1: 1d5x B:93-190 [21624]
    Other proteins in same PDB: d1d5xa2, d1d5xb2, d1d5xc1, d1d5xc2
    complexed with ace, haq

Details for d1d5xb1

PDB Entry: 1d5x (more details), 2.45 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with dipeptide mimetic and seb

SCOP Domain Sequences for d1d5xb1:

Sequence, based on SEQRES records: (download)

>d1d5xb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsltspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1d5xb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
rrvypevtvypaknllvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlv
mletvprsgevytcqvehpsltspltvewra

SCOP Domain Coordinates for d1d5xb1:

Click to download the PDB-style file with coordinates for d1d5xb1.
(The format of our PDB-style files is described here.)

Timeline for d1d5xb1: