Lineage for d3s7vc_ (3s7v C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076457Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2076790Family b.121.6.0: automated matches [227135] (1 protein)
    not a true family
  6. 2076791Protein automated matches [226836] (6 species)
    not a true protein
  7. 2076829Species Ki polyomavirus [TaxId:423445] [226165] (1 PDB entry)
  8. 2076832Domain d3s7vc_: 3s7v C: [216238]
    Other proteins in same PDB: d3s7vf2
    automated match to d1vpsa_

Details for d3s7vc_

PDB Entry: 3s7v (more details), 2.55 Å

PDB Description: unassembled ki polyomavirus vp1 pentamer
PDB Compounds: (C:) Major capsid protein VP1

SCOPe Domain Sequences for d3s7vc_:

Sequence, based on SEQRES records: (download)

>d3s7vc_ b.121.6.0 (C:) automated matches {Ki polyomavirus [TaxId: 423445]}
vevlaavplseetefkvelfvkpvignttaaqdgreptphywsissaihdkesgssikve
etpdadttvcyslaeiappdipnqvsecdmkvwelyrmetellvvplvnalgntngvvhg
lagtqlyfwavggqpldvvgvtptdkykgpttytinppgdprtlhvynsntpkakvtser
ysveswapdpsrndncryfgrvvggaatppvvsygnnstiplldengigilclqgrlyit
cadmlgtansrihtpmarffrlhfrqrrvkn

Sequence, based on observed residues (ATOM records): (download)

>d3s7vc_ b.121.6.0 (C:) automated matches {Ki polyomavirus [TaxId: 423445]}
vevlaavplseetefkvelfvkpvignttagreptphywsissaihdkesgssikveetp
dadttvcyslaeiappdipnqvsecdmkvwelyrmetellvvplvnalgntngvvhglag
tqlyfwavggqpldvvgvtptdkykgpttytinppgdprtlhvynsntpkakvtserysv
eswapdpsrndncryfgrvvggaatppvvsygnnstiplldengigilclqgrlyitcad
mlgtansrihtpmarffrlhfrqrrvkn

SCOPe Domain Coordinates for d3s7vc_:

Click to download the PDB-style file with coordinates for d3s7vc_.
(The format of our PDB-style files is described here.)

Timeline for d3s7vc_: