Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.0: automated matches [227135] (1 protein) not a true family |
Protein automated matches [226836] (7 species) not a true protein |
Species Ki polyomavirus [TaxId:423445] [226165] (1 PDB entry) |
Domain d3s7va_: 3s7v A: [216236] Other proteins in same PDB: d3s7vf2 automated match to d1vpsa_ |
PDB Entry: 3s7v (more details), 2.55 Å
SCOPe Domain Sequences for d3s7va_:
Sequence, based on SEQRES records: (download)
>d3s7va_ b.121.6.0 (A:) automated matches {Ki polyomavirus [TaxId: 423445]} evlaavplseetefkvelfvkpvignttaaqdgreptphywsissaihdkesgssikvee tpdadttvcyslaeiappdipnqvsecdmkvwelyrmetellvvplvnalgntngvvhgl agtqlyfwavggqpldvvgvtptdkykgpttytinppgdprtlhvynsntpkakvtsery sveswapdpsrndncryfgrvvggaatppvvsygnnstiplldengigilclqgrlyitc admlgtansrihtpmarffrlhfrqrrvkn
>d3s7va_ b.121.6.0 (A:) automated matches {Ki polyomavirus [TaxId: 423445]} evlaavplseetefkvelfvkpvignttaeptphywsissaihdkesgssikveetpdad ttvcyslaeiappdimkvwelyrmetellvvplvnalgntngvvhglagtqlyfwavggq pldvvgvtptdkykgpttytinppgdprtlhvynsntpkakvtserysveswapdpsrnd ncryfgrvvggaatppvvsygnnstiplldengigilclqgrlyitcadmlgtansriht pmarffrlhfrqrrvkn
Timeline for d3s7va_: