Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (20 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [226273] (5 PDB entries) |
Domain d3s7oa1: 3s7o A:5-130 [216230] Other proteins in same PDB: d3s7oa2, d3s7oa3 automated match to d1ztua2 complexed with gol, lbv |
PDB Entry: 3s7o (more details), 1.24 Å
SCOPe Domain Sequences for d3s7oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s7oa1 d.110.3.0 (A:5-130) automated matches {Deinococcus radiodurans [TaxId: 1299]} plpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflgq eptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgellil efepte
Timeline for d3s7oa1: