Lineage for d3s7oa1 (3s7o A:5-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970682Species Deinococcus radiodurans [TaxId:1299] [226273] (5 PDB entries)
  8. 2970684Domain d3s7oa1: 3s7o A:5-130 [216230]
    Other proteins in same PDB: d3s7oa2, d3s7oa3
    automated match to d1ztua2
    complexed with gol, lbv

Details for d3s7oa1

PDB Entry: 3s7o (more details), 1.24 Å

PDB Description: Crystal Structure of the Infrared Fluorescent D207H variant of Deinococcus Bacteriophytochrome chromophore binding domain at 1.24 angstrom resolution
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d3s7oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s7oa1 d.110.3.0 (A:5-130) automated matches {Deinococcus radiodurans [TaxId: 1299]}
plpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflgq
eptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgellil
efepte

SCOPe Domain Coordinates for d3s7oa1:

Click to download the PDB-style file with coordinates for d3s7oa1.
(The format of our PDB-style files is described here.)

Timeline for d3s7oa1: