| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species) |
| Domain d1d5xa1: 1d5x A:82-181 [21623] Other proteins in same PDB: d1d5xa2, d1d5xb2, d1d5xc1, d1d5xc2 |
PDB Entry: 1d5x (more details), 2.45 Å
SCOP Domain Sequences for d1d5xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5xa1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1d5xa1:
View in 3DDomains from other chains: (mouse over for more information) d1d5xb1, d1d5xb2, d1d5xc1, d1d5xc2 |