SCOPe 2.08: Domain d3s5yb2: 3s5y B:324-422

Lineage for d3s5yb2 (3s5y B:324-422)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (21 PDB entries)
   alpha-galactosidase A

8. Domain d3s5yb2: 3s5y B:324-422 [216222]
   Other proteins in same PDB: d3s5ya1, d3s5yb1
   automated match to d1r46b1
   complexed with 2pe, acy, dgj, edo, nag

Details for d3s5yb2

PDB Entry: 3s5y, 2.11 Å

PDB Description: pharmacological chaperoning in human alpha-galactosidase

PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d3s5yb2:

Sequence; same for both SEQRES and ATOM records:

>d3s5yb2 b.71.1.1 (B:324-422) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmq

Timeline for d3s5yb2:

• d3s5yb2 first appeared in SCOPe 2.03
  
• d3s5yb2 appears in SCOPe 2.07