Lineage for d3s5pa1 (3s5p A:1-139)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921985Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2921986Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2922038Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2922039Protein automated matches [191196] (11 species)
    not a true protein
  7. 2922058Species Giardia lamblia [TaxId:184922] [226146] (1 PDB entry)
  8. 2922059Domain d3s5pa1: 3s5p A:1-139 [216217]
    Other proteins in same PDB: d3s5pa2, d3s5pb2
    automated match to d3k7sb_
    complexed with so4

Details for d3s5pa1

PDB Entry: 3s5p (more details), 2.3 Å

PDB Description: Crystal structure of ribose-5-phosphate isomerase B RpiB from Giardia lamblia
PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d3s5pa1:

Sequence, based on SEQRES records: (download)

>d3s5pa1 c.121.1.0 (A:1-139) automated matches {Giardia lamblia [TaxId: 184922]}
mkvafasdhggrdlrmflqqrasahgyevmdlgtesdasvdypdfakigceavtsgradc
cilvcgtgigisiaankmkgircalcsteydaemarkhnnanalalggrttgpevaasil
srflstnfeggrhaariak

Sequence, based on observed residues (ATOM records): (download)

>d3s5pa1 c.121.1.0 (A:1-139) automated matches {Giardia lamblia [TaxId: 184922]}
mkvafasdhggrdlrmflqqrasahgyevmdlgtpdfakigceavtsgradccilvcgtg
igisiaankmkgircalcsteydaemarkhnnanalalggrttgpevaasilsrflstnf
eggrhaariak

SCOPe Domain Coordinates for d3s5pa1:

Click to download the PDB-style file with coordinates for d3s5pa1.
(The format of our PDB-style files is described here.)

Timeline for d3s5pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s5pa2