![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family) ![]() |
![]() | Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein) |
![]() | Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226155] (1 PDB entry) |
![]() | Domain d3s4ya2: 3s4y A:159-242 [216208] Other proteins in same PDB: d3s4ya1, d3s4yb1 automated match to d1ig3a1 complexed with ca, so4, tpp, unx |
PDB Entry: 3s4y (more details), 1.8 Å
SCOPe Domain Sequences for d3s4ya2:
Sequence, based on SEQRES records: (download)
>d3s4ya2 b.82.6.1 (A:159-242) Thiamin pyrophosphokinase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]} esliyllqpgkhrlhvdtgmegdwcglipvgqpcmqvtttglkwnltndvlafgtlvsts ntydgsgvvtvetdhpllwtmaik
>d3s4ya2 b.82.6.1 (A:159-242) Thiamin pyrophosphokinase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]} esliyllqpgkhrlhvmegdwcglipvgqpcmqvtttglkwnltndvlafgtlvstsnty dgsgvvtvetdhpllwtmaik
Timeline for d3s4ya2: