Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins) Pfam PF04909; Amidohydrolase; stand-alone domain |
Protein automated matches [227068] (1 species) not a true protein |
Species Polaromonas sp. [TaxId:296591] [226195] (1 PDB entry) |
Domain d3s4tf_: 3s4t F: [216204] automated match to d2dvxa_ complexed with act, cl, epe, gol, so4 |
PDB Entry: 3s4t (more details), 1.9 Å
SCOPe Domain Sequences for d3s4tf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s4tf_ c.1.9.15 (F:) automated matches {Polaromonas sp. [TaxId: 296591]} mngkialeehfateetlmdsagfvpdkdwpelrsrlldiqdrrvrlmdehgietmilsln apavqaiadstranetarrandflaeqvakqptrfrgfaalpmqdpelaarelercvkel gfvgalvngfsqdnrsavplyydmaqywpfwetvqaldvpfylhprnplpsdariydgha wllgptwafgqetavhalrlmgsglfdkypalkiilghmgeglpysmwridhrnawiktt pkypakrkivdyfnenfylttsgnfrtqtlidaileigadrilfstdwpfenidhaadwf entsiseadrkkigwgnaqnlfkl
Timeline for d3s4tf_: