Lineage for d3s4tf_ (3s4t F:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1341936Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
    Pfam PF04909; Amidohydrolase; stand-alone domain
  6. 1341985Protein automated matches [227068] (1 species)
    not a true protein
  7. 1341986Species Polaromonas sp. [TaxId:296591] [226195] (1 PDB entry)
  8. 1341992Domain d3s4tf_: 3s4t F: [216204]
    automated match to d2dvxa_
    complexed with act, cl, epe, gol, so4

Details for d3s4tf_

PDB Entry: 3s4t (more details), 1.9 Å

PDB Description: crystal structure of putative amidohydrolase-2 (efi-target 500288)from polaromonas sp. js666
PDB Compounds: (F:) Amidohydrolase 2

SCOPe Domain Sequences for d3s4tf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s4tf_ c.1.9.15 (F:) automated matches {Polaromonas sp. [TaxId: 296591]}
mngkialeehfateetlmdsagfvpdkdwpelrsrlldiqdrrvrlmdehgietmilsln
apavqaiadstranetarrandflaeqvakqptrfrgfaalpmqdpelaarelercvkel
gfvgalvngfsqdnrsavplyydmaqywpfwetvqaldvpfylhprnplpsdariydgha
wllgptwafgqetavhalrlmgsglfdkypalkiilghmgeglpysmwridhrnawiktt
pkypakrkivdyfnenfylttsgnfrtqtlidaileigadrilfstdwpfenidhaadwf
entsiseadrkkigwgnaqnlfkl

SCOPe Domain Coordinates for d3s4tf_:

Click to download the PDB-style file with coordinates for d3s4tf_.
(The format of our PDB-style files is described here.)

Timeline for d3s4tf_: