Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (38 PDB entries) probably orthologous to the mouse I-E group |
Domain d1d5zb1: 1d5z B:93-190 [21620] Other proteins in same PDB: d1d5za1, d1d5za2, d1d5zb2, d1d5zc1, d1d5zc2 complexed with ace, oda |
PDB Entry: 1d5z (more details), 2 Å
SCOP Domain Sequences for d1d5zb1:
Sequence, based on SEQRES records: (download)
>d1d5zb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd wtfqtlvmletvprsgevytcqvehpsltspltvewra
>d1d5zb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvypevtvypallvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvml etvprsgevytcqvehpsltspltvewra
Timeline for d1d5zb1:
View in 3D Domains from other chains: (mouse over for more information) d1d5za1, d1d5za2, d1d5zc1, d1d5zc2 |