SCOPe 2.08: Domain d3s42a1: 3s42 A:1-252

Lineage for d3s42a1 (3s42 A:1-252)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [226798] (1 PDB entry)

8. Domain d3s42a1: 3s42 A:1-252 [216197]
   Other proteins in same PDB: d3s42a2, d3s42b2
   automated match to d4h3dd_
   complexed with bo3, dms, imd, mla, ni

Details for d3s42a1

PDB Entry: 3s42, 1.45 Å

PDB Description: crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella enterica typhimurium lt2 with malonate and boric acid at the active site

PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3s42a1:

Sequence; same for both SEQRES and ATOM records:

>d3s42a1 c.1.10.0 (A:1-252) automated matches {Salmonella enterica [TaxId: 90371]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva
dlrtvltilhqa

Timeline for d3s42a1:

• d3s42a1 first appeared in SCOPe 2.03, called d3s42a_
  
• d3s42a1 appears in SCOPe 2.07