SCOPe 2.08: Domain d3s41a1: 3s41 A:12-218

Lineage for d3s41a1 (3s41 A:12-218)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)

8. Domain d3s41a1: 3s41 A:12-218 [216195]
   Other proteins in same PDB: d3s41a3
   automated match to d1bdga1
   complexed with glc, na, s41

Details for d3s41a1

PDB Entry: 3s41, 2.18 Å

PDB Description: glucokinase in complex with activator and glucose

PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d3s41a1:

Sequence, based on SEQRES records:

>d3s41a1 c.55.1.0 (A:12-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkekveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsev
gdflsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecis
dfldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikr
rgdfemdvvamvndtvatmiscyyedh

Sequence, based on observed residues (ATOM records):

>d3s41a1 c.55.1.0 (A:12-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkekveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsev
gdflsldlggtnfrvmlvkvgsvktkhqmysipedamtgtaemlfdyisecisdfldkhq
mkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrgdfemd
vvamvndtvatmiscyyedh

Timeline for d3s41a1:

• d3s41a1 first appeared in SCOPe 2.03
  
• d3s41a1 appears in SCOPe 2.07