SCOPe 2.04: Domain d3s3fb_: 3s3f B:

Lineage for d3s3fb_ (3s3f B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (6 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226240] (2 PDB entries)

8. Domain d3s3fb_: 3s3f B: [216193]
   automated match to d2h04a_
   complexed with 1bo, bu1, ipa, vo4

Details for d3s3fb_

PDB Entry: 3s3f, 2.7 Å

PDB Description: Crystal Structure of the catalytic domain of PTP10D from Drosophila melanogaster with a small molecule inhibitor Vanadate

PDB Compounds: (B:) Tyrosine-protein phosphatase 10D

SCOPe Domain Sequences for d3s3fb_:

Sequence; same for both SEQRES and ATOM records:

>d3s3fb_ c.45.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
masrpiliknfaehyrlmsadsdfrfseefeelkhvgrdqpctfadlpcnrpknrftnil
pydhsrfklqpvdddegsdyinanyvpghnsprefivtqgplhstrddfwrmcwesnsra
ivmltrcfekgrekcdqywpndtvpvfygdikvqilndshyadwvmtefmlcrgseqril
rhfhfttwpdfgvpnppqtlvrfvrafrdrigaeqrpivvhcsagvgrsgtfitldrilq
qintsdyvdifgivyamrkervwmvqteqqyicihqcllavlegk

Timeline for d3s3fb_:

• d3s3fb_ first appeared in SCOPe 2.03
  
• d3s3fb_ appears in SCOPe 2.05
  
• d3s3fb_ appears in the current release, SCOPe 2.08, called d3s3fb1