SCOPe 2.06: Domain d3s3fa1: 3s3f A:24-305

Lineage for d3s3fa1 (3s3f A:24-305)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (8 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226240] (2 PDB entries)

8. Domain d3s3fa1: 3s3f A:24-305 [216192]
   Other proteins in same PDB: d3s3fa2, d3s3fb2
   automated match to d2h04a_
   complexed with 1bo, bu1, ipa, vo4

Details for d3s3fa1

PDB Entry: 3s3f, 2.7 Å

PDB Description: Crystal Structure of the catalytic domain of PTP10D from Drosophila melanogaster with a small molecule inhibitor Vanadate

PDB Compounds: (A:) Tyrosine-protein phosphatase 10D

SCOPe Domain Sequences for d3s3fa1:

Sequence; same for both SEQRES and ATOM records:

>d3s3fa1 c.45.1.0 (A:24-305) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rpiliknfaehyrlmsadsdfrfseefeelkhvgrdqpctfadlpcnrpknrftnilpyd
hsrfklqpvdddegsdyinanyvpghnsprefivtqgplhstrddfwrmcwesnsraivm
ltrcfekgrekcdqywpndtvpvfygdikvqilndshyadwvmtefmlcrgseqrilrhf
hfttwpdfgvpnppqtlvrfvrafrdrigaeqrpivvhcsagvgrsgtfitldrilqqin
tsdyvdifgivyamrkervwmvqteqqyicihqcllavlegk

Timeline for d3s3fa1:

• d3s3fa1 first appeared in SCOPe 2.03, called d3s3fa_
  
• d3s3fa1 was called d3s3fa_ in SCOPe 2.05
  
• d3s3fa1 appears in SCOPe 2.07
  
• d3s3fa1 appears in the current release, SCOPe 2.08