SCOPe 2.07: Domain d1d5za1: 1d5z A:82-180

Lineage for d1d5za1 (1d5z A:82-180)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d1d5za1: 1d5z A:82-180 [21619]
   Other proteins in same PDB: d1d5za2, d1d5zb1, d1d5zb2, d1d5zc1, d1d5zc2

Details for d1d5za1

PDB Entry: 1d5z, 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb

PDB Compounds: (A:) protein (hla class II histocompatibility antigen)

SCOPe Domain Sequences for d1d5za1:

Sequence; same for both SEQRES and ATOM records:

>d1d5za1 b.1.1.2 (A:82-180) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

Timeline for d1d5za1:

• d1d5za1 first appeared (with stable ids) in SCOP 1.55
  
• d1d5za1 appears in SCOPe 2.06
  
• d1d5za1 appears in the current release, SCOPe 2.08