Lineage for d3s2va_ (3s2v A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523133Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2523321Domain d3s2va_: 3s2v A: [216182]
    Other proteins in same PDB: d3s2vb2
    automated match to d1ycjb_
    complexed with 3hu, cl, gol, so4

Details for d3s2va_

PDB Entry: 3s2v (more details), 2.5 Å

PDB Description: crystal structure of the ligand binding domain of gluk1 in complex with an antagonist (s)-1-(2'-amino-2'-carboxyethyl)-3-[(2- carboxythien-3-yl)methyl]thieno[3,4-d]pyrimidin-2,4-dione at 2.5 a resolution
PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d3s2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s2va_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyga
qndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvltt
dyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegkl
hmmkekwwrgngcp

SCOPe Domain Coordinates for d3s2va_:

Click to download the PDB-style file with coordinates for d3s2va_.
(The format of our PDB-style files is described here.)

Timeline for d3s2va_: