Lineage for d3s1xe_ (3s1x E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1822171Protein automated matches [190095] (20 species)
    not a true protein
  7. 1822392Species Thermoplasma acidophilum [TaxId:273075] [189712] (6 PDB entries)
  8. 1822397Domain d3s1xe_: 3s1x E: [216180]
    automated match to d3s0ce_
    complexed with i22

Details for d3s1xe_

PDB Entry: 3s1x (more details), 1.65 Å

PDB Description: transaldolase from thermoplasma acidophilum in complex with d- sedoheptulose 7-phosphate schiff-base intermediate
PDB Compounds: (E:) Probable transaldolase

SCOPe Domain Sequences for d3s1xe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s1xe_ c.1.10.1 (E:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
mkifldtanideirtgvnwgivdgvttnptliskeavngkkygdiireilkivdgpvsve
vvstkyegmveearkihglgdnavvkipmtedglraiktlssehintnctlvfnpiqall
aakagvtyvspfvgrlddigedgmqiidmirtifnnyiiktqilvasirnpihvlrsavi
gadvvtvpfnvlkslmkhpktdeglakfledwkkvspdgklil

SCOPe Domain Coordinates for d3s1xe_:

Click to download the PDB-style file with coordinates for d3s1xe_.
(The format of our PDB-style files is described here.)

Timeline for d3s1xe_: