Lineage for d1d5mb1 (1d5m B:93-190)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53149Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)
  7. 53193Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (4 PDB entries)
  8. 53195Domain d1d5mb1: 1d5m B:93-190 [21618]
    Other proteins in same PDB: d1d5ma2, d1d5mb2, d1d5mc1, d1d5mc2

Details for d1d5mb1

PDB Entry: 1d5m (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb
PDB Compounds: (B:)

SCOP Domain Sequences for d1d5mb1:

Sequence, based on SEQRES records: (download)

>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
rrvypevtvypanllvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvm
letvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1d5mb1:

Click to download the PDB-style file with coordinates for d1d5mb1.
(The format of our PDB-style files is described here.)

Timeline for d1d5mb1: