SCOP 1.55: Domain d1d5mb1: 1d5m B:93-190

Lineage for d1d5mb1 (1d5m B:93-190)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (4 PDB entries)
8. Domain d1d5mb1: 1d5m B:93-190 [21618]
   Other proteins in same PDB: d1d5ma2, d1d5mb2, d1d5mc1, d1d5mc2

Details for d1d5mb1

PDB Entry: 1d5m, 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb

SCOP Domain Sequences for d1d5mb1:

Sequence, based on SEQRES records:

>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records):

>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
rrvypevtvypanllvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvm
letvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1d5mb1 are not available.

Timeline for d1d5mb1:

• d1d5mb1 appears in SCOP 1.57
  
• d1d5mb1 appears in the current release, SCOPe 2.08