Lineage for d1d5ma1 (1d5m A:82-181)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760280Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1760288Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 1760295Domain d1d5ma1: 1d5m A:82-181 [21617]
    Other proteins in same PDB: d1d5ma2, d1d5mb1, d1d5mb2, d1d5mc1, d1d5mc2
    complexed with nag

Details for d1d5ma1

PDB Entry: 1d5m (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb
PDB Compounds: (A:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1d5ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ma1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d1d5ma1:

Click to download the PDB-style file with coordinates for d1d5ma1.
(The format of our PDB-style files is described here.)

Timeline for d1d5ma1: