Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (5 PDB entries) |
Domain d1d5ma1: 1d5m A:82-181 [21617] Other proteins in same PDB: d1d5ma2, d1d5mb2, d1d5mc1, d1d5mc2 |
PDB Entry: 1d5m (more details), 2 Å
SCOP Domain Sequences for d1d5ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5ma1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1d5ma1:
View in 3D Domains from other chains: (mouse over for more information) d1d5mb1, d1d5mb2, d1d5mc1, d1d5mc2 |