Lineage for d1d5ma1 (1d5m A:82-181)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159086Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 159136Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (5 PDB entries)
  8. 159139Domain d1d5ma1: 1d5m A:82-181 [21617]
    Other proteins in same PDB: d1d5ma2, d1d5mb2, d1d5mc1, d1d5mc2

Details for d1d5ma1

PDB Entry: 1d5m (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb

SCOP Domain Sequences for d1d5ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ma1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1d5ma1:

Click to download the PDB-style file with coordinates for d1d5ma1.
(The format of our PDB-style files is described here.)

Timeline for d1d5ma1: