Lineage for d1d5ma1 (1d5m A:82-181)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species) - Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [49137] (4 PDB entries)
- Domain d1d5ma1: 1d5m A:82-181 [21617]
Other proteins in same PDB: d1d5ma2, d1d5mb2, d1d5mc1, d1d5mc2
Details for d1d5ma1
PDB Entry: 1d5m (more details), 2 Å
PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb
SCOP Domain Sequences for d1d5ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5ma1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
SCOP Domain Coordinates for d1d5ma1 are not available.
Timeline for d1d5ma1:
- d1d5ma1 appears in SCOP 1.57
- d1d5ma1 appears in the current release, SCOPe 2.08