Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Methylacidiphilum infernorum [TaxId:481448] [195689] (5 PDB entries) |
Domain d3s1ja_: 3s1j A: [216168] automated match to d2zlua_ complexed with act, hem, so4 |
PDB Entry: 3s1j (more details), 1.8 Å
SCOPe Domain Sequences for d3s1ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s1ja_ a.1.1.0 (A:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]} idqkekelikeswkriepnkneigllfyanlfkeeptvsvlfqnpissqsrklmqvlgil vqgidnlegliptlqdlgrrhkqygvvdshyplvgdcllksiqeylgqgfteeakaawtk vygiaaqvmta
Timeline for d3s1ja_: