SCOPe 2.07: Domain d3s1ja_: 3s1j A:

Lineage for d3s1ja_ (3s1j A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (26 species)
   not a true protein

7. Species Methylacidiphilum infernorum [TaxId:481448] [195689] (5 PDB entries)

8. Domain d3s1ja_: 3s1j A: [216168]
   automated match to d2zlua_
   complexed with act, hem, so4

Details for d3s1ja_

PDB Entry: 3s1j, 1.8 Å

PDB Description: Crystal structure of acetate-bound hell's gate globin I

PDB Compounds: (A:) Hemoglobin-like flavoprotein

SCOPe Domain Sequences for d3s1ja_:

Sequence; same for both SEQRES and ATOM records:

>d3s1ja_ a.1.1.0 (A:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}
idqkekelikeswkriepnkneigllfyanlfkeeptvsvlfqnpissqsrklmqvlgil
vqgidnlegliptlqdlgrrhkqygvvdshyplvgdcllksiqeylgqgfteeakaawtk
vygiaaqvmta

Timeline for d3s1ja_:

• d3s1ja_ first appeared in SCOPe 2.03
  
• d3s1ja_ appears in SCOPe 2.06
  
• d3s1ja_ appears in the current release, SCOPe 2.08