![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) ![]() automatically mapped to Pfam PF01194 |
![]() | Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
![]() | Protein RNA polymerase subunit RPB10 [46926] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224845] (1 PDB entry) |
![]() | Domain d3s14j_: 3s14 J: [216152] Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14k_, d3s14l_ automated match to d1twfj_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s14 (more details), 2.85 Å
SCOPe Domain Sequences for d3s14j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s14j_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d3s14j_: