Lineage for d3s14i2 (3s14 I:50-120)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641064Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 2641065Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 2641066Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 2641118Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224953] (1 PDB entry)
  8. 2641120Domain d3s14i2: 3s14 I:50-120 [216151]
    Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14j_, d3s14k_, d3s14l_
    automated match to d1twfi2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14i2

PDB Entry: 3s14 (more details), 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d3s14i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s14i2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

SCOPe Domain Coordinates for d3s14i2:

Click to download the PDB-style file with coordinates for d3s14i2.
(The format of our PDB-style files is described here.)

Timeline for d3s14i2: