Class g: Small proteins [56992] (98 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins) |
Protein RBP9 subunit of RNA polymerase II [57787] (3 species) contains two differently decorated domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224953] (1 PDB entry) |
Domain d3s14i1: 3s14 I:2-49 [216150] Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14j_, d3s14k_, d3s14l_ automated match to d1twfi1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s14 (more details), 2.85 Å
SCOPe Domain Sequences for d3s14i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s14i1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d3s14i1: