SCOPe 2.04: Domain d3s14i1: 3s14 I:2-49

Lineage for d3s14i1 (3s14 I:2-49)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (5 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224953] (1 PDB entry)

8. Domain d3s14i1: 3s14 I:2-49 [216150]
   Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14j_, d3s14k_, d3s14l_
   automated match to d1twfi1
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14i1

PDB Entry: 3s14, 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d3s14i1:

Sequence; same for both SEQRES and ATOM records:

>d3s14i1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d3s14i1:

• d3s14i1 first appeared in SCOPe 2.03
  
• d3s14i1 appears in SCOPe 2.05
  
• d3s14i1 appears in the current release, SCOPe 2.08