Lineage for d1a6aa1 (1a6a A:82-180)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220787Species Human (Homo sapiens), HLA-DR3 [TaxId:9606] [49136] (1 PDB entry)
  8. 220788Domain d1a6aa1: 1a6a A:82-180 [21615]
    Other proteins in same PDB: d1a6aa2, d1a6ab2

Details for d1a6aa1

PDB Entry: 1a6a (more details), 2.75 Å

PDB Description: the structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3

SCOP Domain Sequences for d1a6aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6aa1 b.1.1.2 (A:82-180) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR3}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOP Domain Coordinates for d1a6aa1:

Click to download the PDB-style file with coordinates for d1a6aa1.
(The format of our PDB-style files is described here.)

Timeline for d1a6aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6aa2