SCOP 1.59: Domain d1a6aa1: 1a6a A:82-180

Lineage for d1a6aa1 (1a6a A:82-180)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (11 species)

7. Species Human (Homo sapiens), HLA-DR3 [TaxId:9606] [49136] (1 PDB entry)

8. Domain d1a6aa1: 1a6a A:82-180 [21615]
   Other proteins in same PDB: d1a6aa2, d1a6ab2

Details for d1a6aa1

PDB Entry: 1a6a, 2.75 Å

PDB Description: the structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3

SCOP Domain Sequences for d1a6aa1:

Sequence; same for both SEQRES and ATOM records:

>d1a6aa1 b.1.1.2 (A:82-180) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR3}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

Timeline for d1a6aa1:

• d1a6aa1 first appeared (with stable ids) in SCOP 1.55
  
• d1a6aa1 appears in SCOP 1.57
  
• d1a6aa1 appears in SCOP 1.61
  
• d1a6aa1 appears in the current release, SCOPe 2.08