Lineage for d3s14f_ (3s14 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347782Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2347783Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2347834Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2347835Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 2347870Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224850] (1 PDB entry)
  8. 2347871Domain d3s14f_: 3s14 F: [216148]
    Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_
    automated match to d1twff_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14f_

PDB Entry: 3s14 (more details), 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit RPABC2

SCOPe Domain Sequences for d3s14f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s14f_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekki
plvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d3s14f_:

Click to download the PDB-style file with coordinates for d3s14f_.
(The format of our PDB-style files is described here.)

Timeline for d3s14f_: