Class a: All alpha proteins [46456] (289 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (2 proteins) |
Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224850] (1 PDB entry) |
Domain d3s14f_: 3s14 F: [216148] Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_ automated match to d1twff_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s14 (more details), 2.85 Å
SCOPe Domain Sequences for d3s14f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s14f_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekki plvirrylpdgsfedwsveelivdl
Timeline for d3s14f_: