SCOPe 2.07: Domain d3s14e2: 3s14 E:144-215

Lineage for d3s14e2 (3s14 E:144-215)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families)
   automatically mapped to Pfam PF01191

5. Family d.78.1.1: RPB5 [55288] (2 proteins)

6. Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224935] (1 PDB entry)

8. Domain d3s14e2: 3s14 E:144-215 [216147]
   Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_
   automated match to d1twfe2
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14e2

PDB Entry: 3s14, 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3s14e2:

Sequence; same for both SEQRES and ATOM records:

>d3s14e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d3s14e2:

• d3s14e2 first appeared in SCOPe 2.03
  
• d3s14e2 appears in SCOPe 2.06
  
• d3s14e2 appears in the current release, SCOPe 2.08