Lineage for d3s14e2 (3s14 E:144-215)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958567Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2958568Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2958569Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 2958570Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 2958601Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224935] (1 PDB entry)
  8. 2958602Domain d3s14e2: 3s14 E:144-215 [216147]
    Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_
    automated match to d1twfe2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14e2

PDB Entry: 3s14 (more details), 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3s14e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s14e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d3s14e2:

Click to download the PDB-style file with coordinates for d3s14e2.
(The format of our PDB-style files is described here.)

Timeline for d3s14e2: